PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 223aa    MW: 25419.5 Da    PI: 5.9545
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039771genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +lv+++ ++G ++W++ +++ g+ R++k+c++rw++yl
      Lus10039771 14 KGTWTPEEDMRLVEYISRYGCRNWRRLPKEAGLARCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding48.61.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T++E+  ++ +++ lG++ W+ Ia +m  gRt++++k++w+++l
      Lus10039771  67 RGGFTKDEEATILSLHATLGNK-WSIIATHMS-GRTDNEIKNYWNTHL 112
                      788*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.688961IPR017930Myb domain
SuperFamilySSF466891.87E-2911108IPR009057Homeodomain-like
SMARTSM007174.3E-121363IPR001005SANT/Myb domain
PfamPF002499.8E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-241568IPR009057Homeodomain-like
CDDcd001673.96E-111661No hitNo description
PROSITE profilePS5129424.15262116IPR017930Myb domain
SMARTSM007172.4E-1466114IPR001005SANT/Myb domain
PfamPF002495.7E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2569114IPR009057Homeodomain-like
CDDcd001672.79E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MARTPYVDRN GLKKGTWTPE EDMRLVEYIS RYGCRNWRRL PKEAGLARCG KSCRLRWLNY  60
LRPDIKRGGF TKDEEATILS LHATLGNKWS IIATHMSGRT DNEIKNYWNT HLKKLQPPVL  120
QKEAMCSNFD AADDHHSPDQ QISVGSNASS ETSCVAAEAM PIITSVVAGN EEILISDDFW  180
SQPFMTYGED IDQNEAYGTS SDGFQTEREM LWFYHALMNY SY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27121145106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047495.13e-60PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH46e-54MYB4_ORYSJ; Myb-related protein Myb4
SwissprotP200244e-53MYB1_MAIZE; Myb-related protein Zm1
TrEMBLW9RAQ02e-59W9RAQ0_9R
STRINGPOPTR_0019s14140.15e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-58myb domain protein 93